PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA46G00174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 151aa    MW: 17873.4 Da    PI: 10.9153
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA46G00174genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.2e-1160113457
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  k+ +r+++NRe+A+rsR RK+++ie L+e+v  +  eN++  ++l  l  +++
  AA46G00174  60 EKKRKRMESNRESAKRSRMRKQKQIEDLREEVNRIGLENREISNRLRILLYQIE 113
                 5999***********************************988877766655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-1257121IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-958115No hitNo description
PROSITE profilePS5021710.85259122IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-961111No hitNo description
PfamPF001704.7E-961113IPR004827Basic-leucine zipper domain
CDDcd147022.71E-1162109No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MKSGSDESCA RSHNSGYFAG VSSPQSIELD SEFTKLVKTG SNSFNNRKGL NRPVMKITDE  60
KKRKRMESNR ESAKRSRMRK QKQIEDLREE VNRIGLENRE ISNRLRILLY QIEQVSRVNH  120
QLLSEQEILR RKLSEMRQIL ILRELQIQQQ W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17378KRSRMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404751.12e-53hypothetical protein EUTSA_v10000309mg
TrEMBLV4LQX52e-53V4LQX5_EUTSA; Uncharacterized protein
STRINGAT2G22850.15e-51(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78551840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.24e-48basic leucine-zipper 6